Cart summary

You have no items in your shopping cart.

DYTN Rabbit Polyclonal Antibody (HRP)

DYTN Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2086577

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2086577
CategoryAntibodies
DescriptionDYTN Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human DYTN
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW65kDa
UniProt IDA2CJ06
Protein SequenceSynthetic peptide located within the following region: LAAVEKKEAGNIKERKDELEEEELQELLSKLMDAFNLETPSGPESSVNMD
NCBINP_001087199
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
NoteFor research use only
Expiration Date12 months from date of receipt.