DSCAM Rabbit Polyclonal Antibody

• Catalog Number: orb330400
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DSCAM
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DSCAM
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 220kDa
• Target: DSCAM
• UniProt ID: O60469
• Protein Sequence: Synthetic peptide located within the following region: MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV
• NCBI: NP_001380
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CHD2-42 antibody, anti CHD2-52 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Amount and Sample Type: 10 cm sq plate myc-DSCAM transfected mouse neuro2a cells, Primary Antibody: DSCAM, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: DSCAM.

WB Suggested Anti-DSCAM Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.