DPYSL2 Rabbit Polyclonal Antibody

• Catalog Number: orb581515
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DPYSL2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Zebrafish
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPYSL2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 62kDa
• Target: DPYSL2
• UniProt ID: Q16555
• Protein Sequence: Synthetic peptide located within the following region: NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR
• NCBI: NP_001377
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DRP2, N2A3, CRMP2, DRP-2, ULIP2, CRMP-2, DHPRP2, U
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Amount and Sample Type: 500 ug rat brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: DPYSL2, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: DPYSL2.

WB Suggested Anti-DPYSL2 Antibody, Positive Control: lane 1: 80 ug mouse brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody Dilution: 1:20000.

WB Suggested Anti-DPYSL2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human brain.