DPP4 Rabbit Polyclonal Antibody

• Catalog Number: orb585596
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DPP4
• Target: DPP4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: DSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVH
• UniProt ID: P27487
• MW: 84kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CD26, ADABP, ADCP2, DPPIV, TP103
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_001926

DPP4 antibody - C-terminal region (orb585596), Sample Type: Normal Human Prostate, Primary Antibody dilution: 1 ug/ml, Color/Signal Descriptions: DPP4 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: DPP4.

DPP4 antibody - C-terminal region (orb585596), Sample Type: Normal Human Prostate, Primary Antibody dilution: 1 ug/ml, Color/Signal Descriptions: DPP4 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: DPP4.

Lanes: Lane 1: 15 ug MDA-MB-231 lysate, Lane 2: 15 ug MCF-7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Donkey anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: DPP4.

WB Suggested Anti-DPP4 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.