DPP3 Rabbit Polyclonal Antibody

• Catalog Number: orb579694
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DPP3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DPP3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 82kDa
• Target: DPP3
• UniProt ID: Q9NY33
• Protein Sequence: Synthetic peptide located within the following region: SRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEE
• NCBI: NP_005691
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DPPIII
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. DPP3 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. DPP3 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. DPP3 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-DPP3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. DPP3 is supported by BioGPS gene expression data to be expressed in Jurkat.