DPAGT1 Rabbit Polyclonal Antibody

• Catalog Number: orb586412
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DPAGT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DPAGT1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: DPAGT1
• UniProt ID: Q9H3H5
• Protein Sequence: Synthetic peptide located within the following region: TKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLG
• NCBI: NP_001373
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GPT, ALG7, DGPT, G1PT, UAGT, UGAT, CDG1J, CMS13, D
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. DPAGT1 is supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. DPAGT1 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-DPAGT1 Antibody, Titration: 1.0 ug/ml, Positive Control: PANC1 Whole Cell. DPAGT1 is supported by BioGPS gene expression data to be expressed in PANC1.