DNM1L Rabbit Polyclonal Antibody

• Catalog Number: orb581671
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DNM1L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNM1L
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 82 kDa
• Target: DNM1L
• UniProt ID: O00429
• Protein Sequence: Synthetic peptide located within the following region: IRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVG
• NCBI: NP_036192
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DLP1, DRP1, DVLP, EMPF, OPA5, EMPF1, DYMPLE, HDYNI
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at ~79-80 kDa.

Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): A549 (N03), Negative control (-): HepG2 (HG), Antibody concentration: 3 ug/ml.

Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

WB Suggested Anti-DNM1L Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate. DNM1L is supported by BioGPS gene expression data to be expressed in HeLa.