Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 - 2 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name DNER antibody
Catalog Number orb330621
Species/HostRabbit
ReactivityCanine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
ConjugationUnconjugated
Tested applicationsWB
Immunogen Synthetic peptide located within the following region: DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP
Target DNER
Alternative Names
Product Properties
Form/Appearance Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.
Note For research use only.
Isotype IgG
ClonalityPolyclonal
Purity Protein A purified
MW 50 kDa
Uniprot ID Q8NFT8
NCBI NM_139072
Entrez 92737
Product Description

Rabbit polyclonal antibody to DNER

Validation Images
Western blot analysis of HepG2 cell lysate tissue using DNER antibody
Western blot analysis of HepG2 cell lysate tissue using DNER antibody
Reviews
Write Your Own Review
You're reviewing:DNER antibody - orb330621
Your Rating
We use cookies to provide you with a better service. Carry on browsing if you're happy with this, or find out how to manage cookies notification-close