Dnajc17 Rabbit Polyclonal Antibody

• Catalog Number: orb576319
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Dnajc17
• Target: Dnajc17
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Equine, Guinea pig, Human, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Dnajc17
• Protein Sequence: Synthetic peptide located within the following region: RQDREQRLRGRTENTEGKGTPKLKLKWKCKKEDESQGGYSRDVLLRLLQK
• UniProt ID: Q91WT4
• MW: 34kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: C87112, D9Bwg1371e, 1700025B16Rik
• Note: For research use only
• NCBI: NP_631878

WB Suggested Anti-Dnajc17 Antibody Titration: 0.2-1 ug/ml, Positive Control: Mouse Muscle.