C14orf104 Rabbit Polyclonal Antibody

• Catalog Number: orb326149
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DNAAF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf104
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 91kDa
• Target: DNAAF2
• UniProt ID: Q9NVR5
• Protein Sequence: Synthetic peptide located within the following region: MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG
• NCBI: NP_060609
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ10563 antibody, anti KTU antibody, anti CI
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Application: IHC, Species+tissue/cell type:Human nasal epithelial cells, Primary antibody Dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa Fluor 546, Secondary antibody Dilution: 1:1000.

WB Suggested Anti-C14orf104 Antibody Titration: 0.2-1 ug/mL, Positive Control: Hela cell lysate.