Cart summary

You have no items in your shopping cart.

DMKN Rabbit Polyclonal Antibody (FITC)

DMKN Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2090688

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2090688
CategoryAntibodies
DescriptionDMKN Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Human, Rabbit
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human DMKN
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW43kDa
Protein SequenceSynthetic peptide located within the following region: QPGAGWQEVAAVTSKNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASR
NCBINP_001177276
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesUNQ729, ZD52F10
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.