You have no items in your shopping cart.
DLD Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DLD |
| Target | DLD |
| Protein Sequence | Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
| Molecular Weight | 54 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Lipoamide Dehydrogenase/DLD Rabbit Polyclonal Antibody [orb312105]
FC, ICC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgDLL4 Rabbit Polyclonal Antibody [orb101847]
WB
Bovine, Canine, Equine, Mouse, Porcine
Human, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlDLL4 Rabbit Polyclonal Antibody [orb100896]
WB
Bovine, Canine, Equine, Mouse, Porcine
Human, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlDLD Rabbit Polyclonal Antibody [orb183269]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Human, Sheep, Xenopus
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

DLD antibody - middle region (orb584000) validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.

Sample Tissue: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. DLD is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. DLD is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-DLD Antibody, Catalog Number: orb584000, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-DLD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. DLD is supported by BioGPS gene expression data to be expressed in Jurkat.
Documents Download
Request a Document
Protocol Information
DLD Rabbit Polyclonal Antibody (orb584000)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










