DLD Rabbit Polyclonal Antibody

• Catalog Number: orb584000
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DLD
• Target: DLD
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DLD
• Protein Sequence: Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
• UniProt ID: B2R5X0
• MW: 54 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: E3, LAD, DLDD, DLDH, GCSL, PHE3, OGDC-E3
• Note: For research use only
• NCBI: NP_000099

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

DLD antibody - middle region (orb584000) validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.

Sample Tissue: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. DLD is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. DLD is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-DLD Antibody, Catalog Number: orb584000, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-DLD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. DLD is supported by BioGPS gene expression data to be expressed in Jurkat.