DLAT Rabbit Polyclonal Antibody

• Catalog Number: orb578300
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DLAT
• Target: DLAT
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DLAT
• Protein Sequence: Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR
• UniProt ID: P10515
• MW: 69 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: E2, PBC, DLTA, PDCE2, PDC-E2
• Research Area: Disease Biomarkers
• Note: For research use only
• NCBI: NP_001922

Sample Type: Huh7 lysate (50 ug), Primary Antibody Dilution: 1:200.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms are present from ~68 kDa to ~ 55 kDa.

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.

Rabbit Anti-DLAT Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-DLAT Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.