DLAT Rabbit Polyclonal Antibody

• Catalog Number: orb578301
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DLAT
• Target: DLAT
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Mouse, Porcine, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DLAT
• Protein Sequence: Synthetic peptide located within the following region: DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA
• UniProt ID: Q86YI5
• MW: 69kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: E2, PBC, DLTA, PDCE2, PDC-E2
• Research Area: Disease Biomarkers
• Note: For research use only
• NCBI: NP_001922

WB Suggested Anti-DLAT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. DLAT is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.