Cart summary

You have no items in your shopping cart.

DKFZP564J0863 Rabbit Polyclonal Antibody (Biotin)

DKFZP564J0863 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2116066

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2116066
CategoryAntibodies
DescriptionDKFZP564J0863 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW60kDa
UniProt IDQ6DD88
Protein SequenceSynthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
NCBINP_056274
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesHSN1F
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.