DISP1 Rabbit Polyclonal Antibody

• Catalog Number: orb580993
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DISP1
• Target: DISP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DISP1
• Protein Sequence: Synthetic peptide located within the following region: FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV
• UniProt ID: Q96F81
• MW: 171 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DISPA
• Note: For research use only
• NCBI: NP_116279
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human MDA-MB-435s Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-DISP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.