Cart summary

You have no items in your shopping cart.

DIRC2 Rabbit Polyclonal Antibody (FITC)

DIRC2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2112096

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112096
CategoryAntibodies
DescriptionDIRC2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityEquine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DIRC2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW52kDa
UniProt IDQ96SL1
Protein SequenceSynthetic peptide located within the following region: AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ
NCBINP_116228
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesRCC4, DIRC2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.