Cart summary

You have no items in your shopping cart.

DHTKD1 Rabbit Polyclonal Antibody (Biotin)

DHTKD1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2094523

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2094523
CategoryAntibodies
DescriptionDHTKD1 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human DHTKD1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW102kDa
UniProt IDQ96HY7
Protein SequenceSynthetic peptide located within the following region: YCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQE
NCBINP_061176
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCMT2Q, AMOXAD
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.