DGKH Rabbit Polyclonal Antibody

SKU: orb579562

Description

Rabbit polyclonal antibody to DGKH

Research Area

Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DGKH
• Target: DGKH
• Protein Sequence: Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW
• Molecular Weight: 135kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DGKeta

Positive control (+): Human Brain (BR), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.

Sample Type: Adult mouse cortex, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Red: DGKH Cyan: Nissl (Neurons), Gene Name: DGKH.

WB Suggested Anti-DGKH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human heart.

Quick Database Links

Gene Symbol

DGKH

UniProt

Q86XP1

RefSeq (Protein):NP_821077