Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

DGKH Rabbit Polyclonal Antibody

SKU: orb579562

Description

DGKH Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of DGKH. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human DGKH. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DGKH
TargetDGKH
Protein SequenceSynthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW
Molecular Weight135kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DGKeta

Similar Products

  • DGKH Rabbit Polyclonal Antibody [orb626362]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • DGK-η rabbit pAb Antibody [orb767834]

    ELISA,  IF,  IHC

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • DGKH Antibody [orb685022]

    ELISA,  IF,  IHC

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • DGKH Polyclonal Antibody [orb1420122]

    ICC,  IF,  IHC-Fr,  IHC-P

    Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • DGKH Rabbit Polyclonal Antibody [orb1816846]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

DGKH Rabbit Polyclonal Antibody

Positive control (+): Human Brain (BR), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.

DGKH Rabbit Polyclonal Antibody

Sample Type: Adult mouse cortex, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Red: DGKH Cyan: Nissl (Neurons), Gene Name: DGKH.

DGKH Rabbit Polyclonal Antibody

WB Suggested Anti-DGKH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_821077

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

DGKH Rabbit Polyclonal Antibody (orb579562)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry