You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579562 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DGKH |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DGKH |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 135kDa |
Target | DGKH |
UniProt ID | Q86XP1 |
Protein Sequence | Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW |
NCBI | NP_821077 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DGKeta Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Positive control (+): Human Brain (BR), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.
Sample Type: Adult mouse cortex, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Red: DGKH Cyan: Nissl (Neurons), Gene Name: DGKH.
WB Suggested Anti-DGKH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human heart.
ICC, IF, IHC-Fr, IHC-P | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |