You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb55697 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DENND6A. |
Target | DENND6A |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FAM116A |
Protein Sequence | Synthetic peptide located within the following region: KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF |
UniProt ID | Q8IWF6 |
MW | 67kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | AFI1A, FAM116A |
Research Area | Epigenetics |
Note | For research use only |
NCBI | NP_689891 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-FAM116A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.
WB | |
Bovine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |