DENND5A Rabbit Polyclonal Antibody

• Catalog Number: orb582664
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DENND5A
• Target: DENND5A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human DENND5A
• Protein Sequence: Synthetic peptide located within the following region: RYPENVEWNPFDQDAVGMLCMPKGLAFKTQADPREPQFHAFIITREDGSR
• UniProt ID: Q6IQ26
• MW: 88kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DEE49, EIEE49, RAB6IP1
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_001230183.1
• Expiration Date: 12 months from date of receipt.

Sample Type: 721_B Whole cell lysates, Antibody dilution: 1.0 ug/ml.