You have no items in your shopping cart.
Dendroaspis Natriuretic Peptide
SKU: orb2693699
Description
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| Molecular Weight | 4190.72 |
| Protein Sequence | EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA (Disulfide bridge: Cys7-Cys23) |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−Dendroaspis angusticeps Natriuretic peptide DNP Protein [orb1477528]
Greater than 85% as determined by SDS-PAGE.
19.5 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Dendroaspis angusticeps Natriuretic peptide DNP [orb2657878]
Greater than 95% as determined by SDS-PAGE.
33.1 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Dendroaspis angusticeps Natriuretic peptide DNP [orb2658354]
Greater than 95% as determined by SDS-PAGE.
5.7 kDa
Yeast
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
others
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Dendroaspis Natriuretic Peptide (orb2693699)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

