You have no items in your shopping cart.
Cart summary
Dendroaspis Natriuretic Peptide
Catalog Number: orb2693699
| Catalog Number | orb2693699 |
|---|---|
| Category | Proteins |
| Description | Dendroaspis Natriuretic Peptide is a vasodilator peptide that can be isolated from animal venom. |
| Target | others |
| Purity | ≥95% |
| Protein Sequence | EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA (Disulfide bridge: Cys7-Cys23) |
| MW | 4190.72 |
| CAS Number | 255721-52-9 |
| Formula | C180H282N56O56S2 |
| Note | For research use only |
- Item 1 of 1
Recombinant Dendroaspis angusticeps Natriuretic peptide DNP [orb2658354]
Greater than 95% as determined by SDS-PAGE.
5.7 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Recombinant Dendroaspis angusticeps Natriuretic peptide DNP [orb2657878]
Greater than 95% as determined by SDS-PAGE.
33.1 kDa
Mammalian cell
100 μg, 1 mg, 20 μg - Item 1 of 1
Dendroaspis angusticeps Natriuretic peptide DNP Protein [orb1477528]
Greater than 85% as determined by SDS-PAGE.
19.5 kDa
E.coli
1 mg, 20 μg, 100 μg [Des-Arg30, Des-Pro31]-Dendroaspis Natriuretic Peptide [orb364069]
> 95%
3937.42
Synthetic
10 mg, 1 mg, 5 mg
