You have no items in your shopping cart.
[Des-Arg30,Des-Pro31]-Dendroaspis Natriuretic Peptide
SKU: orb2693690
Description
Research Area
Cardiovascular Research; Musculoskeletal & Connective Tissue Research
Images & Validation
−![[Des-Arg30,Des-Pro31]-Dendroaspis Natriuretic Peptide](/images/quality_badge_proteins.png)
Key Properties
−| MW | 3937.42 |
|---|---|
| Purity | ≥95% |
| Formula | C169H263N51O54S2 |
| Protein Sequence | EVKYDPCFGHKIDRINHVSNLGCPSLRDPNAPSTSA(Disulfide bridge:Cys7-Cys23) |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−[Des-Arg30, Des-Pro31]-Dendroaspis Natriuretic Peptide [orb364069]
> 95%
3937.42
Synthetic
5 mg, 1 mg, 10 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide