You have no items in your shopping cart.
[Des-Arg30,Des-Pro31]-Dendroaspis Natriuretic Peptide
SKU: orb2693690
Description
Images & Validation
−![[Des-Arg30,Des-Pro31]-Dendroaspis Natriuretic Peptide](/images/quality_badge_proteins.png)
Key Properties
−| Molecular Weight | 3937.42 |
|---|---|
| Protein Sequence | EVKYDPCFGHKIDRINHVSNLGCPSLRDPNAPSTSA(Disulfide bridge:Cys7-Cys23) |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Similar Products
−[Des-Arg30, Des-Pro31]-Dendroaspis Natriuretic Peptide [orb364069]
> 95%
3937.42
Synthetic
10 mg, 1 mg, 5 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
[Des-Arg30,Des-Pro31]-Dendroaspis Natriuretic Peptide (orb2693690)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review