DDX47 Rabbit Polyclonal Antibody

• Catalog Number: orb577955
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DDX47
• Target: DDX47
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DDX47
• Protein Sequence: Synthetic peptide located within the following region: AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
• UniProt ID: Q9H0S4
• MW: 50kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RRP3, E4-DBP, HQ0256, MSTP162
• Research Area: Epigenetics & Chromatin, Molecular Biology, Stem C
• Note: For research use only
• NCBI: NP_057439

Rabbit Anti-DDX47 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-DDX47 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.