Item 1 of 3

DDAH2 antibody

Catalog Number: orb330989

Catalog Number	orb330989
Category	Antibodies
Description	Rabbit polyclonal antibody to DDAH2
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	IHC, WB
Predicted Reactivity	Animal, Bovine, Canine, Human, Mouse, Rabbit, Rat
Reactivity	Canine, Equine, Human, Mouse, Rat
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human DDAH2
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	31kDa
Target	DDAH2
UniProt ID	O95865
Protein Sequence	Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG
NCBI	NP_039268
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	anti DDAH antibody, anti DDAHII antibody, anti G6a Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.

Immunohistochemical staining of human Uterus tissue using DDAH2 antibody

Western blot analysis of Fetal Brain Lysate tissue using DDAH2 antibody

Immunohistochemical staining of human Uterus tissue using DDAH2 antibody