Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

DDAH2 Rabbit Polyclonal Antibody

SKU: orb330989

Description

DDAH2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of DDAH2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human DDAH2. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DDAH2
TargetDDAH2
Protein SequenceSynthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG
Molecular Weight31kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DDAH antibody, anti DDAHII antibody, anti G6a antibody, anti NG30 antibody

Similar Products

  • DDAH2 Rabbit Polyclonal Antibody [orb371735]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • DDAH2 Rabbit Polyclonal Antibody [orb626296]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • DDAH2 Rabbit Polyclonal Antibody [orb341091]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl, 30 μl
  • DDAH2 Rabbit Polyclonal Antibody [orb2955806]

    ELISA,  IHC,  WB

    Bovine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • DDAH2 Rabbit Polyclonal Antibody [orb5966]

    ELISA,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

DDAH2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

DDAH2 Rabbit Polyclonal Antibody

Human Uterus

DDAH2 Rabbit Polyclonal Antibody

Immunohistochemistry with Human Uterus lysate tissue at an antibody concentration of 5.0 ug/ml using anti-DDAH2 antibody (orb330989).

DDAH2 Rabbit Polyclonal Antibody

WB Suggested Anti-DDAH2 Antibody Titration: 1 ug/ml, Positive Control: Fetal Brain Lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_039268

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

DDAH2 Rabbit Polyclonal Antibody (orb330989)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry