DDAH2 Rabbit Polyclonal Antibody

SKU: orb330989

Description

Rabbit polyclonal antibody to DDAH2

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDAH2
• Target: DDAH2
• Protein Sequence: Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG
• Molecular Weight: 31kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DDAH antibody, anti DDAHII antibody, anti G6a antibody, anti NG30 antibody

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Human Uterus

Immunohistochemistry with Human Uterus lysate tissue at an antibody concentration of 5.0 ug/ml using anti-DDAH2 antibody (orb330989).

WB Suggested Anti-DDAH2 Antibody Titration: 1 ug/ml, Positive Control: Fetal Brain Lysate.

Quick Database Links

Gene Symbol

DDAH2

UniProt

O95865

RefSeq (Protein):NP_039268