You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578479 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DCXR |
Target | DCXR |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DCXR |
Protein Sequence | Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM |
UniProt ID | Q7Z4W1 |
MW | 27kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | XR, DCR, HCR2, P34H, HCRII, KIDCR, PNTSU, SDR20C1 |
Research Area | Epigenetics |
Note | For research use only |
NCBI | NP_057370 |
Expiration Date | 12 months from date of receipt. |
Human kidney
WB Suggested Anti-DCXR Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
FC, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |