DCXR Rabbit Polyclonal Antibody

• Catalog Number: orb578479
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DCXR
• Target: DCXR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DCXR
• Protein Sequence: Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM
• UniProt ID: Q7Z4W1
• MW: 27kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: XR, DCR, HCR2, P34H, HCRII, KIDCR, PNTSU, SDR20C1
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_057370

Human kidney

WB Suggested Anti-DCXR Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.