DCAF16 Rabbit Polyclonal Antibody

• Catalog Number: orb327218
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DCAF16
• Target: DCAF16
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCAF16
• Protein Sequence: Synthetic peptide located within the following region: SEEEENISYLNESSGEEWDSSEEEDSMVPNLSPLESLAWQVKCLLKYSTT
• UniProt ID: Q9NXF7
• MW: 24 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti DCAF16 antibody, anti C4orf30 antibody, anti
• Note: For research use only
• NCBI: XP_005248228
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.