DBT Rabbit Polyclonal Antibody

• Catalog Number: orb581529
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DBT
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DBT
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: DBT
• UniProt ID: P11182
• Protein Sequence: Synthetic peptide located within the following region: NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW
• NCBI: NP_001909
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: E2, E2B, BCATE2, BCKADE2, BCKAD-E2, BCKDH-E2, BCOA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 0.5 ug/ml.

Positive control (+): Human Liver (LI), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded human kidney tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded human skin tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded human spleen tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

WB Suggested Anti-DBT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate. There is BioGPS gene expression data showing that DBT is expressed in HT1080.