Cart summary

You have no items in your shopping cart.

DBNL Rabbit Polyclonal Antibody (Biotin)

DBNL Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2106682

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2106682
CategoryAntibodies
DescriptionDBNL Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Guinea pig, Human, Mouse
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DBNL
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW48kDa
UniProt IDQ9UJU6
Protein SequenceSynthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
NCBINP_001014436
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesABP1, HIP55, SH3P7, HIP-55
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.