You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330118 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DAZL |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rat, Sheep |
Reactivity | Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DAZL |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 33kDa |
Target | DAZL |
UniProt ID | Q92904 |
Protein Sequence | Synthetic peptide located within the following region: EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR |
NCBI | NP_001342 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti DAZH antibody, anti DAZL1 antibody, anti DAZL Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of 721_B cell lysate tissue using DAZL antibody
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating