You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb577842 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to DAZ3 |
| Target | DAZ3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Guinea pig, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DAZ3 |
| Protein Sequence | Synthetic peptide located within the following region: PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF |
| UniProt ID | Q2KHN7 |
| MW | 49kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | pDP1679 |
| Research Area | Molecular Biology, Stem Cell & Developmental Biolo Read more... |
| Note | For research use only |
| NCBI | NP_065097 |

WB Suggested Anti-DAZ3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate. There is BioGPS gene expression data showing that DAZ3 is expressed in OVCAR3.
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Guinea pig, Human, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Guinea pig, Human, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Guinea pig, Human, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review