Cart summary

You have no items in your shopping cart.

DAZ2 Rabbit Polyclonal Antibody (FITC)

DAZ2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2125992

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2125992
CategoryAntibodies
DescriptionDAZ2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DAZ2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW59kDa
UniProt IDQ2KHN6
Protein SequenceSynthetic peptide located within the following region: MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ
NCBINP_001005785
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namespDP1678
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.