You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586602 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DAND5 |
Target | DAND5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human DAND5 |
Protein Sequence | Synthetic peptide located within the following region: SGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAF |
UniProt ID | Q8N907 |
MW | 21kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SP1, CER2, COCO, CRL2, CERL2, DANTE, GREM3, CKTSF1 Read more... |
Note | For research use only |
NCBI | NP_689867 |
WB Suggested Anti-DAND5 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.
IF, IHC-Fr, IHC-P | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Human | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |