You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586163 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Daam2 |
Target | Daam2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Daam2 |
Protein Sequence | Synthetic peptide located within the following region: LTDKNREAVFALPPEKKWQIYCSKRKEQEDPNKLATSWP' target='_blank'>RFAELVDELDLTDKNREAVFALPPEKKWQIYCSKRKEQEDPNKLATSWP |
UniProt ID | Q80U19 |
MW | 57kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | AI843643, AW557870, 2310016D11Rik |
Note | For research use only |
NCBI | NP_001008232 |
Sample Type: Mouse Heart lysates, Antibody dilution: 1.0 ug/ml.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Cy3 |
ICC, IF | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Cy7 |