CYP4F2 Rabbit Polyclonal Antibody

• Catalog Number: orb585744
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CYP4F2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 60 kDa
• Target: CYP4F2
• UniProt ID: P78329
• Protein Sequence: Synthetic peptide located within the following region: QAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGL
• NCBI: NP_001073
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CPF2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Positive control (+): Human Liver (LI), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.

WB Suggested Anti-CYP4F2 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell. CYP4F2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.