You have no items in your shopping cart.
Cart summary
Item 1 of 1
CYP3A7 Rabbit Polyclonal Antibody
Catalog Number: orb578219
| Catalog Number | orb578219 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CYP3A7 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7 |
| Concentration | 1.0 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 57kDa |
| Target | CYP3A7 |
| UniProt ID | P24462 |
| Protein Sequence | Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI |
| NCBI | NP_000756 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | CP37, CYPIIIA7, P450HLp2, P450-HFLA, P-450111A7, P Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CYP3A7 Antibody Titration: 2.5 ug/ml, Positive Control: Human Liver.
- Item 1 of 3
- Item 1 of 2
Anti-Cytochrome P450 3A7 Antibody [orb213817]
IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 1
CYP3A7 purified MaxPab rabbit polyclonal antibody (D01P) [orb2293847]
WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 1
- Item 1 of 1
