Cart summary

You have no items in your shopping cart.

CYP3A43 Rabbit Polyclonal Antibody (FITC)

CYP3A43 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2112666

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112666
CategoryAntibodies
DescriptionCYP3A43 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CYP3A43
Protein SequenceSynthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR
UniProt IDQ9HB55
MW58kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesMGC119315, MGC119316
NoteFor research use only
NCBINP_073731
  • CYP3A43 Rabbit Polyclonal Antibody (FITC) [orb2112669]

    IHC,  WB

    Bovine, Canine, Guinea pig, Human, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    FITC

    100 μl