CYP2C8 Rabbit Polyclonal Antibody

• Catalog Number: orb584581
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CYP2C8
• Target: CYP2C8
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen for Anti-CYP2C8 antibody is: synthetic peptide directed towards the C-terminal region of Human CP2C8
• Protein Sequence: Synthetic peptide located within the following region: NPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTI
• UniProt ID: P10632
• MW: 42 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CPC8, CYPIIC8, CYP2C8DM, MP-12/MP-20
• Research Area: Cell Biology
• Note: For research use only

WB Suggested Anti-CP2C8 antibody Titration: 1 ug/ml, Sample Type: Human Stomach Tumor.