You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578223 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CYP2B6 |
| Target | CYP2B6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CYP2B6 |
| Protein Sequence | Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL |
| UniProt ID | P20813 |
| MW | 56 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CPB6, EFVM, IIB1, P450, CYP2B, CYP2B7, CYP2B7P, CY Read more... |
| Research Area | Disease Biomarkers, Signal Transduction |
| Note | For research use only |
| NCBI | NP_000758 |

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 33 kDa.

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-CYP2B6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: THP-1 cell lysate.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
FC, WB | |
Canine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review