CYP1B1 Rabbit Polyclonal Antibody

• Catalog Number: orb581433
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CYP1B1
• Target: CYP1B1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP1B1
• Protein Sequence: Synthetic peptide located within the following region: AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY
• UniProt ID: Q16678
• MW: 61kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CP1B, ASGD6, GLC3A, CYPIB1, P4501B1
• Note: For research use only
• NCBI: NP_000095

Lanes: Lane 1: Human lung microsome lysate, Lane 2-5: 150 ug mouse lung microsome lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: CYP1B1.

WB Suggested Anti-CYP1B1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.