CYP1A1 Rabbit Polyclonal Antibody

SKU: orb578043

Description

Rabbit polyclonal antibody to CYP1A1

Research Area

Metabolism Research

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
• Target: CYP1A1
• Protein Sequence: Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV
• Molecular Weight: 58 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX

Sample Type: Human Kidney, Dilution: 1:100.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Liver Tumor, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-CYP1A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Quick Database Links

Gene Symbol

CYP1A1

UniProt

P04798

RefSeq (Protein):NP_000490