You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578043 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CYP1A1 |
Target | CYP1A1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1 |
Protein Sequence | Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
UniProt ID | P04798 |
MW | 58 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P45 Read more... |
Note | For research use only |
NCBI | NP_000490 |
Sample Type: Human Kidney, Dilution: 1:100.
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.
Sample Tissue: Human Liver Tumor, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-CYP1A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Primate, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Monkey, Mouse, Rat | |
Polyclonal | |
Unconjugated |