You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578197 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CYP11B2 |
Target | CYP11B2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Equine |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CYP11B2 |
Protein Sequence | Synthetic peptide located within the following region: RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI |
UniProt ID | P19099 |
MW | 55kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CPN2, ALDOS, CYP11B, CYP11BL, CYPXIB2, P450C18, P- Read more... |
Note | For research use only |
NCBI | NP_000489 |
Sample type: 1. HEK293TN-GFP-hcyp11B1 (75 ug), 2. HEK293TN-GFP-hcyp11B2 (75 ug), Primary Dilution: 1:100, Secondary Antibody: mouse anti-Rabbit HRP, Secondary Dilution: 1:10000, Film Exposed for: 15 minutes.
WB Suggested Anti-CYP11B2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: OVCAR-3 cell lysate.
FC, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |