CYP11B2 Rabbit Polyclonal Antibody

• Catalog Number: orb578197
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CYP11B2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Equine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP11B2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: CYP11B2
• UniProt ID: P19099
• Protein Sequence: Synthetic peptide located within the following region: RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI
• NCBI: NP_000489
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CPN2, ALDOS, CYP11B, CYP11BL, CYPXIB2, P450C18, P-
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample type: 1. HEK293TN-GFP-hcyp11B1 (75 ug), 2. HEK293TN-GFP-hcyp11B2 (75 ug), Primary Dilution: 1:100, Secondary Antibody: mouse anti-Rabbit HRP, Secondary Dilution: 1:10000, Film Exposed for: 15 minutes.

WB Suggested Anti-CYP11B2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: OVCAR-3 cell lysate.