You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb55682 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CY24B. |
Target | CYBB |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CY24B |
Protein Sequence | Synthetic peptide located within the following region: YGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG |
UniProt ID | P04839 |
MW | 62 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CGD, NOX2, IMD34, AMCBX2, GP91-1, GP91PHOX, p91-PH Read more... |
Note | For research use only |
NCBI | NP_000388 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment.
Sample Tissue: HepG2 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.
IHC Information: Lung, Human: Formalin-Fixed, Paraffin-Embedded (FFPE).
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.