You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324975 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CXCR2 |
Target | CXCR2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IL8RB |
Protein Sequence | Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF |
UniProt ID | P25025 |
MW | 41kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CD182 antibody, anti CDw128b antibody, anti C Read more... |
Note | For research use only |
NCBI | NP_001548 |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.
ELISA, IF, IHC-P, WB | |
Human, Mouse | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |