You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb592726 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CXCL3 |
| Target | CXCL3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CXCL3 |
| Protein Sequence | Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
| UniProt ID | P19876 |
| MW | 11kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | GRO3, GROg, MIP2B, SCYB3, MIP-2b, CINC-2b |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| NCBI | NP_002081 |
| Expiration Date | 12 months from date of receipt. |

25 ug of the indicated whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
ELISA, IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy3 |
IF | |
Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
APC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review