CXCL3 Rabbit Polyclonal Antibody

• Catalog Number: orb592726
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CXCL3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CXCL3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 11kDa
• Target: CXCL3
• UniProt ID: P19876
• Protein Sequence: Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
• NCBI: NP_002081
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GRO3, GROg, MIP2B, SCYB3, MIP-2b, CINC-2b
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.