CTTN Rabbit Polyclonal Antibody

• Catalog Number: orb581557
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CTTN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTTN
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: CTTN
• UniProt ID: Q8N707
• Protein Sequence: Synthetic peptide located within the following region: KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG
• NCBI: NP_005222
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EMS1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CTTN antibody - N-terminal region (orb581557), Catalog Number: orb581557, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-CTTN Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.