CTSK Rabbit Polyclonal Antibody

• Catalog Number: orb331115
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CTSK
• Target: CTSK
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CTSK
• Protein Sequence: Synthetic peptide located within the following region: SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY
• UniProt ID: P43235
• MW: 37kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CTS02 antibody, anti CTSO antibody, anti CTSO
• Note: For research use only
• NCBI: NP_000387

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

WB Suggested Anti-CTSK Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.