CTRL Rabbit Polyclonal Antibody

• Catalog Number: orb574854
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CTRL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTRL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: CTRL
• UniProt ID: P40313
• Protein Sequence: Synthetic peptide located within the following region: LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL
• NCBI: NP_001898
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CTRL1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-CTRL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.