Cart summary

You have no items in your shopping cart.

CTRC Rabbit Polyclonal Antibody (Biotin)

CTRC Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2135885

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2135885
CategoryAntibodies
DescriptionCTRC Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CTRC
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW27kDa
UniProt IDQ99895
Protein SequenceSynthetic peptide located within the following region: LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK
NCBINP_009203
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCLCR, ELA4
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.