You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579282 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Ctns |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Mouse Ctns |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 42 kDa |
Target | Ctns |
UniProt ID | P57757 |
Protein Sequence | Synthetic peptide located within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP |
NCBI | NP_112541 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AI195360, AW049661 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse tissue cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform is 42 kDa and a 45 kDa isoform also contains the immunogen sequence, the protein is processed to ~38 kDa, and it is also glycosylated.
Sample Type: Mouse Lung lysates, Antibody Dilution: 1.0 ug/ml.
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |