Ctns Rabbit Polyclonal Antibody

• Catalog Number: orb579282
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Ctns
• Target: Ctns
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Ctns
• Protein Sequence: Synthetic peptide located within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP
• UniProt ID: P57757
• MW: 42 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AI195360, AW049661
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_112541

25 ug of the indicated Mouse tissue cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform is 42 kDa and a 45 kDa isoform also contains the immunogen sequence, the protein is processed to ~38 kDa, and it is also glycosylated.

Sample Type: Mouse Lung lysates, Antibody Dilution: 1.0 ug/ml.