You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb579282 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Ctns |
| Target | Ctns |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Mouse Ctns |
| Protein Sequence | Synthetic peptide located within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP |
| UniProt ID | P57757 |
| MW | 42 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | AI195360, AW049661 |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_112541 |

25 ug of the indicated Mouse tissue cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform is 42 kDa and a 45 kDa isoform also contains the immunogen sequence, the protein is processed to ~38 kDa, and it is also glycosylated.

Sample Type: Mouse Lung lysates, Antibody Dilution: 1.0 ug/ml.
WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review